Human Monoclonal Abs

Abs I

E535 50 units
EUR 166.8

Human Monoclonal Laboratories manufactures the human monoclonal abs reagents distributed by Genprice. The Human Monoclonal Abs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Abs

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Abs information

HRP*Monoclonal Mouse Anti- Human Fab

C030203-10ml 10ml
EUR 2148

HRP*Monoclonal Mouse Anti- Human Fab

C030203-1ml 1ml
EUR 424.8

HRP*Monoclonal Mouse Anti- Human IgA

C030249-10ml 10ml
EUR 2148

HRP*Monoclonal Mouse Anti- Human IgA

C030249-1ml 1ml
EUR 424.8

FITC*Monoclonal Mouse Anti- Human FC

C030602-10ml 10ml
EUR 2148

FITC*Monoclonal Mouse Anti- Human FC

C030602-1ml 1ml
EUR 424.8

Abscisic acid monoclonal antibody

10R-11489 1 mg
EUR 891.6
Description: Mouse anti- abscisic acid monoclonal antibody

anti-XPA (human) antibody, monoclonal

70-031 50ug
EUR 496.8
Description: The anti-XPA (human) antibody, monoclonal is available in Europe and for worldwide shipping via Gentaur.

Midkine (MK) Monoclonal Antibody (Human)

4-MAA631Hu22
  • EUR 289.20
  • EUR 2900.40
  • EUR 724.80
  • EUR 361.20
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Midkine (MK)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu21
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

Leptin (LEP) Monoclonal Antibody (Human)

4-MAA084Hu22
  • EUR 285.60
  • EUR 2845.20
  • EUR 711.60
  • EUR 356.40
  • EUR 252.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Leptin (LEP)

HRP*Monoclonal Mouse Anti- Human IgG2

C030245-10ml 10ml
EUR 3162

HRP*Monoclonal Mouse Anti- Human IgG2

C030245-1ml 1ml
EUR 525.6

HRP*Monoclonal Mouse Anti- Human IgG3

C030246-10ml 10ml
EUR 3162

HRP*Monoclonal Mouse Anti- Human IgG3

C030246-1ml 1ml
EUR 525.6

HRP*Monoclonal Mouse Anti- Human IgG4

C030247-10ml 10ml
EUR 3162

HRP*Monoclonal Mouse Anti- Human IgG4

C030247-1ml 1ml
EUR 525.6