Human Monoclonal Abs

Abs I

E535 50 units
EUR 166.8

Human Monoclonal Laboratories manufactures the human monoclonal abs reagents distributed by Genprice. The Human Monoclonal Abs reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Abs

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

Abs cell/lidBlackQS/GLP10mm700ul - EACH

EACH
EUR 402.45

Spill Tray ABS Yellow Large

EACH
EUR 91.2

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Abs information

Human CD7 Monoclonal antibody

7A-100T 100 test
EUR 264

Human CD7 Monoclonal antibody

7F-100T 100 test
EUR 209

Human CD7 Monoclonal antibody

7PE-100T 100 test
EUR 297

Human CD4 Monoclonal antibody

4A-100T 100 test
EUR 259.6

Human CD4 Monoclonal antibody

4AC750-100T 100 test
EUR 457.6

Human CD4 Monoclonal antibody

4CFB-100T 100 test
EUR 292.6

Human CD4 Monoclonal antibody

4F-100T 100 test
EUR 215.6

Human CD4 Monoclonal antibody

4PE-100T 100 test
EUR 266.2

Human CD4 Monoclonal antibody

4PP-100T 100 test
EUR 290.4

Human CD4 Monoclonal antibody

4PPC5.5-100T 100 test
EUR 292.6

Monoclonal Human IgM Antibody

AMM03207G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human Human IgM. The antibodies are raised in Mouse.

Human CPA Monoclonal antibody

CPAA-100T 100 test
EUR 445.5

Human CD8 Monoclonal antibody

8F1-100T 100 test
EUR 215.6

Human CD8 Monoclonal antibody

8PE1-100T 100 test
EUR 237.6

Human CD8 Monoclonal antibody

8PPC5.5-100T 100 test
EUR 358.6

Human CD8 Monoclonal antibody

8A1-100T 100 test
EUR 259.6

Human CD8 Monoclonal antibody

8AC750-100T 100 test
EUR 446.6